Theragen Bio

Research Data

Human SCARD1(Scavenger Receptor Class D Member 1) ELISA Kit

Human SCARD1(Scavenger Receptor Class D Member 1) ELISA Kit

Scavenger Receptor Class D Member 1 (SCARD1) Antibody

20-abx178316
  • EUR 1149.00
  • EUR 565.00
  • 1 mg
  • 200 ug
  • Please enquire.

Recombinant Scavenger Receptor Class D Member 1 (SCARD1)

4-RPB257Mu01
  • EUR 548.00
  • EUR 250.00
  • EUR 1780.00
  • EUR 660.00
  • EUR 1220.00
  • EUR 430.00
  • EUR 4300.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P31996
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 61.4kDa
  • Isoelectric Point: 8
Description: Recombinant Mouse Scavenger Receptor Class D Member 1 expressed in: E.coli

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

20-abx156733
  • EUR 7112.00
  • EUR 3792.00
  • EUR 879.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-10x96wellstestplate 10x96-wells test plate
EUR 4502.43
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-1x48wellstestplate 1x48-wells test plate
EUR 458.44
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-1x96wellstestplate 1x96-wells test plate
EUR 612.05
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-5x96wellstestplate 5x96-wells test plate
EUR 2454.23
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

4-SEB257Hu
  • EUR 4553.00
  • EUR 2405.00
  • EUR 613.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Scavenger Receptor Class D Member 1 elisa. Alternative names of the recognized antigen: CD68
  • GP110
  • Macrosialin
  • Macrophage Antigen CD68
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Scavenger Receptor Class D Member 1 (SCARD1) Protein

20-abx654994
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.

Human Scavenger Receptor Class D Member 1 (SCARD1) CLIA Kit

20-abx492558
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

Mouse Scavenger Receptor Class D Member 1 (SCARD1) Protein

20-abx167510
  • EUR 759.00
  • EUR 300.00
  • EUR 2388.00
  • EUR 913.00
  • EUR 537.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

ELISA kit for Human SCARD1 (Scavenger Receptor Class D Member 1)

ELK5088 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class D Member 1 (SCARD1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
  • Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class D Member 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse)

4-PAB257Mu01
  • EUR 243.00
  • EUR 2457.00
  • EUR 613.00
  • EUR 305.00
  • EUR 212.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1)

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC

4-PAB257Mu01-APC
  • EUR 340.00
  • EUR 3203.00
  • EUR 894.00
  • EUR 432.00
  • EUR 217.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Biotinylated

4-PAB257Mu01-Biotin
  • EUR 307.00
  • EUR 2407.00
  • EUR 714.00
  • EUR 375.00
  • EUR 217.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Biotin.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Cy3

4-PAB257Mu01-Cy3
  • EUR 411.00
  • EUR 4229.00
  • EUR 1151.00
  • EUR 535.00
  • EUR 248.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Cy3.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), FITC

4-PAB257Mu01-FITC
  • EUR 292.00
  • EUR 2582.00
  • EUR 735.00
  • EUR 366.00
  • EUR 194.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with FITC.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), HRP

4-PAB257Mu01-HRP
  • EUR 311.00
  • EUR 2792.00
  • EUR 791.00
  • EUR 391.00
  • EUR 205.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with HRP.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), PE

4-PAB257Mu01-PE
  • EUR 292.00
  • EUR 2582.00
  • EUR 735.00
  • EUR 366.00
  • EUR 194.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with PE.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC-Cy7

4-PAB257Mu01-APC-Cy7
  • EUR 560.00
  • EUR 6286.00
  • EUR 1669.00
  • EUR 745.00
  • EUR 315.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC-Cy7.

Human Scavenger receptor class B member 1 ELISA kit

E01S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Scavenger receptor class B member 1 ELISA kit

E01S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Scavenger receptor class B member 1 ELISA kit

E01S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit

E03S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit

E03S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit

E03S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit

E02S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit

E02S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit

E02S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human SCARD1(Scavenger Receptor Class D Member 1) ELISA Kit